HORDB

ID: hor006758
Uniprot ID: Q6UW32
Protein name: Insulin growth factor-like family member 1
Gene name: IGFL1
Organism: Homo sapiens (Human)
Family: IGFL family
Source: Human
Expression: Detected in ovary and spinal cord.
Disease: NA
Comments: NA
Taxonomy: Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
GO MF: GO:0005102 signaling receptor binding; GO:0005515 protein binding
GO BP: NA
GO CC: GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence: APVAPMTPYLMLCQPHKRCGDKFYDPLQHCCYDDAVVPLARTQTCGNCTFRVCFEQCCPWTFMVKLINQNCDSARTSDDRLCRSVS
Length: 86
Propeptide: MAPRGCIVAVFAIFCISRLLCSHGAPVAPMTPYLMLCQPHKRCGDKFYDPLQHCCYDDAVVPLARTQTCGNCTFRVCFEQCCPWTFMVKLINQNCDSARTSDDRLCRSVS
Signal peptide: MAPRGCIVAVFAIFCISRLLCSHG
Modification: NA
Glycosylation: T47 N-linked (GlcNAc...) asparagine
Mutagenesis: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor006758_AF2.pdb

hor006758_ESM.pdb

Mass:	1133172	Formula:	C420H652N120O124S14
Absent amino acids:		Common amino acids:	C
pI:	7.54	Basic residues:	11
Polar residues:	29	Hydrophobic residues:	23
Hydrophobicity:	-22.56	Boman Index:	-15541
Half-Life:	4.4 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	57.79
Instability Index:	4979.77	Extinction Coefficient cystines:	10595
Absorbance 280nm:	124.65

PubMed ID: 16890402
Title: IGFL: A secreted family with conserved cysteine residues and similarities to the IGF superfamily.
PubMed ID: 12975309
Title: The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
PubMed ID: 15057824
Title: The DNA sequence and biology of human chromosome 19.
PubMed ID: 15340161
Title: Signal peptide prediction based on analysis of experimentally verified cleavage sites.
PubMed ID: 21454693
Title: Murine insulin growth factor-like (IGFL) and human IGFL1 proteins are induced in inflammatory skin conditions and bind to a novel tumor necrosis factor receptor family member, IGFLR1.