General Information

  • ID:  hor006758
  • Uniprot ID:  Q6UW32
  • Protein name:  Insulin growth factor-like family member 1
  • Gene name:  IGFL1
  • Organism:  Homo sapiens (Human)
  • Family:  IGFL family
  • Source:  Human
  • Expression:  Detected in ovary and spinal cord.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005102 signaling receptor binding; GO:0005515 protein binding
  • GO BP:  NA
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  APVAPMTPYLMLCQPHKRCGDKFYDPLQHCCYDDAVVPLARTQTCGNCTFRVCFEQCCPWTFMVKLINQNCDSARTSDDRLCRSVS
  • Length:  86(25-110)
  • Propeptide:  MAPRGCIVAVFAIFCISRLLCSHGAPVAPMTPYLMLCQPHKRCGDKFYDPLQHCCYDDAVVPLARTQTCGNCTFRVCFEQCCPWTFMVKLINQNCDSARTSDDRLCRSVS
  • Signal peptide:  MAPRGCIVAVFAIFCISRLLCSHG
  • Modification:  NA
  • Glycosylation:  T47 N-linked (GlcNAc...) asparagine
  • Mutagenesis:  NA

Activity

  • Function:  Probable ligand of the IGFLR1 cell membrane receptor.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q6UW32-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006758_AF2.pdbhor006758_ESM.pdb

Physical Information

Mass: 1133172 Formula: C420H652N120O124S14
Absent amino acids: Common amino acids: C
pI: 7.54 Basic residues: 11
Polar residues: 29 Hydrophobic residues: 23
Hydrophobicity: -22.56 Boman Index: -15541
Half-Life / Aliphatic Index: 4.4 hour Aliphatic Index: 57.79
Instability Index: 4979.77 Extinction Coefficient cystines: 10595
Absorbance 280nm: 124.65

Literature

  • PubMed ID:  16890402
  • Title:  IGFL: A secreted family with conserved cysteine residues and similarities to the IGF superfamily.
  • PubMed ID:  12975309
  • Title:  The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessm
  • PubMed ID:  15057824
  • Title:  
  • PubMed ID:  15340161
  • Title:  
  • PubMed ID:  21454693
  • Title: